Review




Structured Review

MultiSynTech gmbh automated multiple peptide synthesizer syroii
Automated Multiple Peptide Synthesizer Syroii, supplied by MultiSynTech gmbh, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/automated+multiple+peptide+synthesizer+syroii/syro+ii+peptide+synthesizer/pmc12088828-57-7-10
Average 90 stars, based on 1 article reviews
automated multiple peptide synthesizer syroii - by Bioz Stars, 2026-09
90/100 stars

Images

Related Articles

other:

Article Title: Phospholipid-driven differences determine the action of the synthetic antimicrobial peptide OP-145 on Gram-positive bacterial and mammalian membrane model systems.
Article Snippet: OP-145 (acetyl-IGKEFKRIVERIKRFLRELVRPLR-amide) was prepared by solid phase strategies on an automated multiple peptide synthesizer (SyroII, MultiSyntech, Witten, Germany) as described previously [32].

Article Title: Induction heating combined with antibiotics or SAAP-148 effectively reduces biofilm-embedded Staphylococcus aureus on a fracture-related implant mimic
Article Snippet: Solid phase chemistry using an automated multiple peptide synthesizer (SyroII; MultiSyntech, Germany) was used to synthesize SAAP-148, as described previously.

Article Title: Peptide inhibitors of toxins derived from LL-37
Article Snippet: The following peptidic compounds, each of them comprising 24 amino acids, the compounds herein coded as P60, P60.4, P60.Ac, and P60.4Ac were prepared by solid phase strategies on an automated multiple peptide synthesizer (SyroII, MultiSyntech, Witten, Germany).

Synthesized:

Article Title: SARS- and other coronaviruses.
Article Snippet: .. In our institute, peptides are synthesized by solid-phase strategies on an automated multiple peptide synthesizer (SyroII, MultiSynTech, Witten, Germany). ..

Article Title: Aminopeptidase-resistant peptides are targeted to lysosomes and subsequently degraded.
Article Snippet: .. The various fluorescent peptides were synthesized by solid phase strategies using an automated multiple peptide synthesizer (SyroII; MultiSyntech). ..

Article Title: Development of novel LL-37 derived antimicrobial peptides with LPS and LTA neutralizing and antimicrobial activities for therapeutic application.
Article Snippet: .. Peptides were synthesized by solid phase strategies on an automated multiple peptide synthesizer (SyroII, MultiSyntech, Witten, Germany). ..

Article Title: SAAP-148 Eradicates MRSA Persisters Within Mature Biofilm Models Simulating Prosthetic Joint Infection
Article Snippet: .. SAAP-148 (LKRVWKRVFKLLKRYWRQLKKPVR), LL 37 ([LL-37, 37 aa]), and pexiganan (GIGKFLKKAKKFGKAFVKILKK), all N-terminal acetylated, C-terminal amidated, were synthesized by solid phase strategies on an automated multiple peptide synthesizer (SyroII, MultiSyntech, Witten, Germany) as described elsewhere ( ; ; ). ..



Similar Products

90
MultiSynTech gmbh automated multiple peptide synthesizer syroii
Automated Multiple Peptide Synthesizer Syroii, supplied by MultiSynTech gmbh, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/automated+multiple+peptide+synthesizer+syroii/syro+ii+peptide+synthesizer/pmc12088828-57-7-10
Average 90 stars, based on 1 article reviews
automated multiple peptide synthesizer syroii - by Bioz Stars, 2026-09
90/100 stars
  Buy from Supplier

90
MultiSynTech gmbh automated multiple-peptide synthesizer syroii
Automated Multiple Peptide Synthesizer Syroii, supplied by MultiSynTech gmbh, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/automated+multiple+peptide+synthesizer+syroii/syro+ii+peptide+synthesizer/pmc04914645-63-17-20
Average 90 stars, based on 1 article reviews
automated multiple-peptide synthesizer syroii - by Bioz Stars, 2026-09
90/100 stars
  Buy from Supplier

90
MultiSynTech gmbh automated multiple peptide synthesizer (syroii
Automated Multiple Peptide Synthesizer (Syroii, supplied by MultiSynTech gmbh, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/automated+multiple+peptide+synthesizer+syroii/syro+ii+peptide+synthesizer/us07803756-297-31-34
Average 90 stars, based on 1 article reviews
automated multiple peptide synthesizer (syroii - by Bioz Stars, 2026-09
90/100 stars
  Buy from Supplier

Image Search Results